Lineage for d3lvjd_ (3lvj D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2957073Fold d.68: IF3-like [55199] (8 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 2957373Superfamily d.68.3: SirA-like [64307] (1 family) (S)
  5. 2957374Family d.68.3.3: SirA-like [88852] (5 proteins)
    predicted redox protein, regulator of disulfide bond formation
  6. 2957387Protein automated matches [191153] (1 species)
    not a true protein
  7. 2957388Species Escherichia coli [TaxId:155864] [189315] (2 PDB entries)
  8. 2957390Domain d3lvjd_: 3lvj D: [180592]
    Other proteins in same PDB: d3lvja_, d3lvjb_
    automated match to d1dcja_
    protein/RNA complex; complexed with plp

Details for d3lvjd_

PDB Entry: 3lvj (more details), 2.44 Å

PDB Description: crystal structure of e.coli iscs-tusa complex (form 1)
PDB Compounds: (D:) Sulfurtransferase tusA

SCOPe Domain Sequences for d3lvjd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lvjd_ d.68.3.3 (D:) automated matches {Escherichia coli [TaxId: 155864]}
lfsspdhtldalglrcpepvmmvrktvrnmqpgetlliiaddpattrdipgfctfmehel
vaketdglpyrylirkg

SCOPe Domain Coordinates for d3lvjd_:

Click to download the PDB-style file with coordinates for d3lvjd_.
(The format of our PDB-style files is described here.)

Timeline for d3lvjd_: