Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.227: OsmC-like [82783] (1 superfamily) swapped dimer of beta(3)-alpha-beta(2)-alpha(2)-beta subunits; mixed beta-sheet; order: 321[4][5][6]; buried helix |
Superfamily d.227.1: OsmC-like [82784] (3 families) |
Family d.227.1.0: automated matches [191395] (1 protein) not a true family |
Protein automated matches [190512] (7 species) not a true protein |
Species Vibrio cholerae [TaxId:243277] [188637] (3 PDB entries) |
Domain d3lusa_: 3lus A: [180574] Other proteins in same PDB: d3lusb2 automated match to d1uspa_ complexed with x8z |
PDB Entry: 3lus (more details), 1.96 Å
SCOPe Domain Sequences for d3lusa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lusa_ d.227.1.0 (A:) automated matches {Vibrio cholerae [TaxId: 243277]} rnknmstiyqtsatasagrngvvstedkllelnlsypkemggsgtatnpeqlfavgyaac fsnailhvareakvalkeapvtatvgigpngqggfalsvalaahialedeqarqlvtvah qvcpysnavrgnidvqvsvnglal
Timeline for d3lusa_: