SCOPe 2.08: Domain d3lupa1: 3lup A:1-282

Lineage for d3lupa1 (3lup A:1-282)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.119: DAK1/DegV-like [82548] (1 superfamily)
   2 different domains; d1: [core: 3 layers, a/b/a; parallel sheet of 5 strands, order: 2134]; D2: [2 layers, a/b; mixed sheet of 6 strands, order 321645; strands 2 and 6 are antiparallel to the rest]

4. Superfamily c.119.1: DAK1/DegV-like [82549] (3 families)
   domain folds and architecture show some similarity to the tubulin-like GTPases; the nucleotide-binding sites of the Dihydroxyacetone kinase and tubulin families are different

5. Family c.119.1.0: automated matches [191443] (1 protein)
   not a true family

6. Protein automated matches [190655] (13 species)
   not a true protein

7. Species Streptococcus agalactiae [TaxId:208435] [189256] (1 PDB entry)

8. Domain d3lupa1: 3lup A:1-282 [180573]
   Other proteins in same PDB: d3lupa2
   automated match to d1pzxb_
   complexed with ela, gol

Details for d3lupa1

PDB Entry: 3lup, 2.65 Å

PDB Description: crystal structure of fatty acid binding degv family protein sag1342 from streptococcus agalactiae

PDB Compounds: (A:) DegV family protein

SCOPe Domain Sequences for d3lupa1:

Sequence; same for both SEQRES and ATOM records:

>d3lupa1 c.119.1.0 (A:1-282) automated matches {Streptococcus agalactiae [TaxId: 208435]}
mklalitdtsaylpeaienhedvyvldipiiidgktyiegqnltldqyydklaaskelpk
tsqpslaelddllcqlekegythvlglfiaagisgfwqniqflieehpnltiafpdtkit
sapqgnlvrnalmcsregmdfdvivnkiqsqiekiegfivvndlnhlvkggrlsngsaii
gnllsikpvlhfneegkivvyekvrtekkalkrlaeivkemtadgeydiaiihsraqdka
eqlynllakaglkddleivsfggviathlgegavafgitpkn

Timeline for d3lupa1:

• d3lupa1 first appeared in SCOPe 2.01, called d3lupa_
  
• d3lupa1 appears in SCOPe 2.07