SCOPe 2.03: Domain d3ltwa_: 3ltw A:

Lineage for d3ltwa_ (3ltw A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (23 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.5: Arylamine N-acetyltransferase [54047] (2 proteins)
   fold similar to that of the factor XIII catalytic domain
   automatically mapped to Pfam PF00797

6. Protein automated matches [190090] (4 species)
   not a true protein

7. Species Mycobacterium marinum [TaxId:216594] [189390] (1 PDB entry)

8. Domain d3ltwa_: 3ltw A: [180570]
   automated match to d1gx3a_
   complexed with fmt, hlz

Details for d3ltwa_

PDB Entry: 3ltw, 2.1 Å

PDB Description: The structure of mycobacterium marinum arylamine n-acetyltransferase in complex with hydralazine

PDB Compounds: (A:) Arylamine N-acetyltransferase Nat

SCOPe Domain Sequences for d3ltwa_:

Sequence; same for both SEQRES and ATOM records:

>d3ltwa_ d.3.1.5 (A:) automated matches {Mycobacterium marinum [TaxId: 216594]}
dltgyldrinyrgatdptldvlrdlvsahtgaiafenldplmgvpvddlsaealadklvd
rrrggycyehngligyvlaelgyrvrrlagrvvwlappdaptpaqthtvlavtfpgcqgp
ylvdvgfggmtptaplrletgtvqqtalepyrlddrgdglvlqamvrdewqalyefstlt
rpqvdlrvgswfvsthptshfvtglmaatvaddarwnlmgrnlaihrrggtekilledaa
avvdtlgdrfginvadvgergrlearidkvcf

Timeline for d3ltwa_:

• d3ltwa_ first appeared in SCOPe 2.01
  
• d3ltwa_ appears in SCOPe 2.02
  
• d3ltwa_ appears in SCOPe 2.04
  
• d3ltwa_ appears in the current release, SCOPe 2.08