Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (23 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.5: Arylamine N-acetyltransferase [54047] (2 proteins) fold similar to that of the factor XIII catalytic domain automatically mapped to Pfam PF00797 |
Protein automated matches [190090] (4 species) not a true protein |
Species Mycobacterium marinum [TaxId:216594] [189390] (1 PDB entry) |
Domain d3ltwa_: 3ltw A: [180570] automated match to d1gx3a_ complexed with fmt, hlz |
PDB Entry: 3ltw (more details), 2.1 Å
SCOPe Domain Sequences for d3ltwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ltwa_ d.3.1.5 (A:) automated matches {Mycobacterium marinum [TaxId: 216594]} dltgyldrinyrgatdptldvlrdlvsahtgaiafenldplmgvpvddlsaealadklvd rrrggycyehngligyvlaelgyrvrrlagrvvwlappdaptpaqthtvlavtfpgcqgp ylvdvgfggmtptaplrletgtvqqtalepyrlddrgdglvlqamvrdewqalyefstlt rpqvdlrvgswfvsthptshfvtglmaatvaddarwnlmgrnlaihrrggtekilledaa avvdtlgdrfginvadvgergrlearidkvcf
Timeline for d3ltwa_: