SCOPe 2.04: Domain d3lsda_: 3lsd A:

Lineage for d3lsda_ (3lsd A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187655] (38 PDB entries)

8. Domain d3lsda_: 3lsd A: [180539]
   automated match to d1a3ka_

Details for d3lsda_

PDB Entry: 3lsd, 2.03 Å

PDB Description: N-Domain of human adhesion/growth-regulatory galectin-9

PDB Compounds: (A:) Galectin-9

SCOPe Domain Sequences for d3lsda_:

Sequence; same for both SEQRES and ATOM records:

>d3lsda_ b.29.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sqapylspavpfsgtiqgglqdglqitvngtvlsssgtrfavnfqtgfsgndiafhfnpr
fedggyvvcntrqngswgpeerkthmpfqkgmpfdlcflvqssdfkvmvngilfvqyfhr
vpfhrvdtisvngsvqlsyisfq

Timeline for d3lsda_:

• d3lsda_ first appeared in SCOPe 2.01
  
• d3lsda_ appears in SCOPe 2.03
  
• d3lsda_ appears in SCOPe 2.05
  
• d3lsda_ appears in the current release, SCOPe 2.08