SCOPe 2.08: Domain d3lqvb_: 3lqv B:

Lineage for d3lqvb_ (3lqv B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families)

5. Family d.58.7.1: Canonical RBD [54929] (70 proteins)
   Pfam PF00076
   Pfam PF13893

6. Protein automated matches [190332] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187155] (29 PDB entries)

8. Domain d3lqvb_: 3lqv B: [180520]
   automated match to d2f9da1
   complexed with ade

Details for d3lqvb_

PDB Entry: 3lqv, 2.38 Å

PDB Description: branch recognition by sf3b14

PDB Compounds: (B:) Pre-mRNA branch site protein p14

SCOPe Domain Sequences for d3lqvb_:

Sequence; same for both SEQRES and ATOM records:

>d3lqvb_ d.58.7.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
irlppevnrilyirnlpykitaeemydifgkygpirqirvgntpetrgtayvvyedifda
knavdhlsgfnvsnrylvvlyynanrafqkmdtkkkeeqlkllkekygintdppk

Timeline for d3lqvb_:

• d3lqvb_ first appeared in SCOPe 2.01
  
• d3lqvb_ appears in SCOPe 2.07