Lineage for d9icia1 (9ici A:9-91)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 444234Fold a.60: SAM domain-like [47768] (13 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 444386Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (1 family) (S)
    contains one classic and one pseudo HhH motifs
  5. 444387Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins)
  6. 444388Protein DNA polymerase beta, N-terminal (8 kD)-domain [47804] (2 species)
    topologically similar to the second domain
  7. 444389Species Human (Homo sapiens) [TaxId:9606] [47805] (92 PDB entries)
  8. 444466Domain d9icia1: 9ici A:9-91 [18049]
    Other proteins in same PDB: d9icia3, d9icia4

Details for d9icia1

PDB Entry: 9ici (more details), 3.1 Å

PDB Description: dna polymerase beta (pol b) (e.c.2.7.7.7) complexed with seven base pairs of dna; soaked in the presence of dttp (1 millimolar) and zncl2 (1 millimolar)

SCOP Domain Sequences for d9icia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d9icia1 a.60.6.1 (A:9-91) DNA polymerase beta, N-terminal (8 kD)-domain {Human (Homo sapiens)}
etlnggitdmltelanfeknvsqaihkynayrkaasviakyphkiksgaeakklpgvgtk
iaekideflatgklrklekirqd

SCOP Domain Coordinates for d9icia1:

Click to download the PDB-style file with coordinates for d9icia1.
(The format of our PDB-style files is described here.)

Timeline for d9icia1: