SCOPe 2.04: Domain d8icya1: 8icy A:9-91

Lineage for d8icya1 (8icy A:9-91)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families)
   contains one classic and one pseudo HhH motifs

5. Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins)

6. Protein DNA polymerase beta, N-terminal (8 kD)-domain [47804] (2 species)
   topologically similar to the second domain

7. Species Human (Homo sapiens) [TaxId:9606] [47805] (143 PDB entries)
   Uniprot P06746

8. Domain d8icya1: 8icy A:9-91 [18048]
   Other proteins in same PDB: d8icya3, d8icya4
   protein/DNA complex; complexed with mn, na, ttp

Details for d8icya1

PDB Entry: 8icy, 3.1 Å

PDB Description: dna polymerase beta (e.c.2.7.7.7)/dna complex + thymidine-5'-triphosphate, soaked in the presence of dttp and mncl2

PDB Compounds: (A:) protein (DNA polymerase beta (e.c.2.7.7.7))

SCOPe Domain Sequences for d8icya1:

Sequence; same for both SEQRES and ATOM records:

>d8icya1 a.60.6.1 (A:9-91) DNA polymerase beta, N-terminal (8 kD)-domain {Human (Homo sapiens) [TaxId: 9606]}
etlnggitdmltelanfeknvsqaihkynayrkaasviakyphkiksgaeakklpgvgtk
iaekideflatgklrklekirqd

Timeline for d8icya1:

• d8icya1 first appeared (with stable ids) in SCOP 1.55
  
• d8icya1 appears in SCOPe 2.03
  
• d8icya1 appears in SCOPe 2.05
  
• d8icya1 appears in the current release, SCOPe 2.08