Lineage for d8icva1 (8icv A:9-91)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 214550Fold a.60: SAM domain-like [47768] (13 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 214655Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (1 family) (S)
    contains one classic and one pseudo HhH motifs
  5. 214656Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (2 proteins)
  6. 214657Protein DNA polymerase beta, N-terminal (8 kD)-domain [47804] (2 species)
    topologically similar to the second domain
  7. 214658Species Human (Homo sapiens) [TaxId:9606] [47805] (92 PDB entries)
  8. 214727Domain d8icva1: 8icv A:9-91 [18047]
    Other proteins in same PDB: d8icva3, d8icva4
    protein/DNA complex; complexed with dgt, mn, na

Details for d8icva1

PDB Entry: 8icv (more details), 3.2 Å

PDB Description: dna polymerase beta (pol b) (e.c.2.7.7.7) complexed with seven base pairs of dna; soaked in the presence of dgtp (1 millimolar) and mncl2 (5 millimolar)

SCOP Domain Sequences for d8icva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d8icva1 a.60.6.1 (A:9-91) DNA polymerase beta, N-terminal (8 kD)-domain {Human (Homo sapiens)}
etlnggitdmltelanfeknvsqaihkynayrkaasviakyphkiksgaeakklpgvgtk
iaekideflatgklrklekirqd

SCOP Domain Coordinates for d8icva1:

Click to download the PDB-style file with coordinates for d8icva1.
(The format of our PDB-style files is described here.)

Timeline for d8icva1: