Lineage for d8icja1 (8icj A:9-91)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 214550Fold a.60: SAM domain-like [47768] (13 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 214655Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (1 family) (S)
    contains one classic and one pseudo HhH motifs
  5. 214656Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (2 proteins)
  6. 214657Protein DNA polymerase beta, N-terminal (8 kD)-domain [47804] (2 species)
    topologically similar to the second domain
  7. 214658Species Human (Homo sapiens) [TaxId:9606] [47805] (92 PDB entries)
  8. 214725Domain d8icja1: 8icj A:9-91 [18045]
    Other proteins in same PDB: d8icja3, d8icja4
    protein/DNA complex; complexed with na, ttp

Details for d8icja1

PDB Entry: 8icj (more details), 3.2 Å

PDB Description: dna polymerase beta (e.c.2.7.7.7)/dna complex + thymidine-5'-triphosphate, soaked in the presence of dttp and mgcl2

SCOP Domain Sequences for d8icja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d8icja1 a.60.6.1 (A:9-91) DNA polymerase beta, N-terminal (8 kD)-domain {Human (Homo sapiens)}
etlnggitdmltelanfeknvsqaihkynayrkaasviakyphkiksgaeakklpgvgtk
iaekideflatgklrklekirqd

SCOP Domain Coordinates for d8icja1:

Click to download the PDB-style file with coordinates for d8icja1.
(The format of our PDB-style files is described here.)

Timeline for d8icja1: