Lineage for d3lo3c1 (3lo3 C:2-92)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949708Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2950158Family d.58.4.0: automated matches [191316] (1 protein)
    not a true family
  6. 2950159Protein automated matches [190081] (33 species)
    not a true protein
  7. 2950229Species Colwellia psychrerythraea [TaxId:167879] [189235] (1 PDB entry)
  8. 2950232Domain d3lo3c1: 3lo3 C:2-92 [180438]
    Other proteins in same PDB: d3lo3a2, d3lo3b2, d3lo3c2, d3lo3d2, d3lo3e2, d3lo3f2, d3lo3g2, d3lo3h2, d3lo3i2, d3lo3j2, d3lo3k2, d3lo3l2, d3lo3m2, d3lo3n2, d3lo3o2, d3lo3p2, d3lo3q2, d3lo3r2, d3lo3s2, d3lo3t2, d3lo3u2, d3lo3v2, d3lo3w2, d3lo3x2, d3lo3y2, d3lo3z2
    automated match to d2fiua1
    complexed with gol

Details for d3lo3c1

PDB Entry: 3lo3 (more details), 2.38 Å

PDB Description: The crystal structure of a conserved functionally unknown protein from Colwellia psychrerythraea 34H.
PDB Compounds: (C:) uncharacterized conserved protein

SCOPe Domain Sequences for d3lo3c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lo3c1 d.58.4.0 (C:2-92) automated matches {Colwellia psychrerythraea [TaxId: 167879]}
tayiivgltpkdaeklqqygarvastlakysgevlvkgsveqlhgkfehkaqvilefpsr
edaynwyhseeyqalistrdlgmdsqfqlig

SCOPe Domain Coordinates for d3lo3c1:

Click to download the PDB-style file with coordinates for d3lo3c1.
(The format of our PDB-style files is described here.)

Timeline for d3lo3c1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3lo3c2
View in 3D
Domains from other chains:
(mouse over for more information)
d3lo3a1, d3lo3a2, d3lo3b1, d3lo3b2, d3lo3d1, d3lo3d2, d3lo3e1, d3lo3e2, d3lo3f1, d3lo3f2, d3lo3g1, d3lo3g2, d3lo3h1, d3lo3h2, d3lo3i1, d3lo3i2, d3lo3j1, d3lo3j2, d3lo3k1, d3lo3k2, d3lo3l1, d3lo3l2, d3lo3m1, d3lo3m2, d3lo3n1, d3lo3n2, d3lo3o1, d3lo3o2, d3lo3p1, d3lo3p2, d3lo3q1, d3lo3q2, d3lo3r1, d3lo3r2, d3lo3s1, d3lo3s2, d3lo3t1, d3lo3t2, d3lo3u1, d3lo3u2, d3lo3v1, d3lo3v2, d3lo3w1, d3lo3w2, d3lo3x1, d3lo3x2, d3lo3y1, d3lo3y2, d3lo3z1, d3lo3z2