Lineage for d3lnwc_ (3lnw C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2965911Fold d.94: HPr-like [55593] (2 superfamilies)
    beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423
  4. 2965912Superfamily d.94.1: HPr-like [55594] (2 families) (S)
  5. 2966008Family d.94.1.0: automated matches [191653] (1 protein)
    not a true family
  6. 2966009Protein automated matches [191210] (2 species)
    not a true protein
  7. 2966014Species Thermoanaerobacter tengcongensis [TaxId:273068] [189569] (5 PDB entries)
  8. 2966027Domain d3lnwc_: 3lnw C: [180428]
    automated match to d1k1ca_

Details for d3lnwc_

PDB Entry: 3lnw (more details), 2.3 Å

PDB Description: Close correlation of protein thermostability and self-buried area rate revealed by crystal structure of HPr from Thermoanaerobacter tengcongensis MB4
PDB Compounds: (C:) Phosphotransferase system, HPr-related proteins

SCOPe Domain Sequences for d3lnwc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lnwc_ d.94.1.0 (C:) automated matches {Thermoanaerobacter tengcongensis [TaxId: 273068]}
mkevtieiknktglharpaalfvqtaskfssqiwvekdnkkvnaksimgimslgvsqgnv
vklsaegddeeeaikalvdlieskfg

SCOPe Domain Coordinates for d3lnwc_:

Click to download the PDB-style file with coordinates for d3lnwc_.
(The format of our PDB-style files is described here.)

Timeline for d3lnwc_: