SCOPe 2.08: Domain d3ln8a_: 3ln8 A:

Lineage for d3ln8a_ (3ln8 A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (2 families)
   can be classified as disulfide-rich

5. Family d.5.1.0: automated matches [191478] (1 protein)
   not a true family

6. Protein automated matches [190767] (7 species)
   not a true protein

7. Species Zebrafish (Danio rerio) [TaxId:7955] [188473] (5 PDB entries)

8. Domain d3ln8a_: 3ln8 A: [180409]
   automated match to d1k58a_
   complexed with so4

Details for d3ln8a_

PDB Entry: 3ln8, 1.61 Å

PDB Description: The X-ray structure of Zf-RNase-1 from a new crystal form at pH 7.3

PDB Compounds: (A:) hydrolase

SCOPe Domain Sequences for d3ln8a_:

Sequence; same for both SEQRES and ATOM records:

>d3ln8a_ d.5.1.0 (A:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
mhvkeryknflnqhvgpdmsvqrcnseigpnnrkitlsgtdngckpvntfilankrlikt
vcgragspqgnmvrsnqpfpvvkcvlnngerhpyceyrgtrstryivlkceegwpvhyhe
devnvg

Timeline for d3ln8a_:

• d3ln8a_ first appeared in SCOPe 2.01
  
• d3ln8a_ appears in SCOPe 2.07