Lineage for d1zqna1 (1zqn A:9-91)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 282277Fold a.60: SAM domain-like [47768] (13 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 282385Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (1 family) (S)
    contains one classic and one pseudo HhH motifs
  5. 282386Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (2 proteins)
  6. 282387Protein DNA polymerase beta, N-terminal (8 kD)-domain [47804] (2 species)
    topologically similar to the second domain
  7. 282388Species Human (Homo sapiens) [TaxId:9606] [47805] (92 PDB entries)
  8. 282445Domain d1zqna1: 1zqn A:9-91 [18034]
    Other proteins in same PDB: d1zqna3, d1zqna4
    protein/DNA complex; complexed with ba

Details for d1zqna1

PDB Entry: 1zqn (more details), 3 Å

PDB Description: dna polymerase beta (pol b) (e.c.2.7.7.7) complexed with seven base pairs of dna; soaked in the presence of bacl2 (15 millimolar) and nacl (15 millimolar)

SCOP Domain Sequences for d1zqna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zqna1 a.60.6.1 (A:9-91) DNA polymerase beta, N-terminal (8 kD)-domain {Human (Homo sapiens)}
etlnggitdmltelanfeknvsqaihkynayrkaasviakyphkiksgaeakklpgvgtk
iaekideflatgklrklekirqd

SCOP Domain Coordinates for d1zqna1:

Click to download the PDB-style file with coordinates for d1zqna1.
(The format of our PDB-style files is described here.)

Timeline for d1zqna1: