Lineage for d3ljta1 (3ljt A:264-480)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2528985Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2528986Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2530179Family d.92.1.0: automated matches [191495] (1 protein)
    not a true family
  6. 2530180Protein automated matches [190805] (17 species)
    not a true protein
  7. 2530208Species Human (Homo sapiens) [TaxId:9606] [188286] (57 PDB entries)
  8. 2530221Domain d3ljta1: 3ljt A:264-480 [180330]
    Other proteins in same PDB: d3ljta2
    automated match to d1r54a_
    complexed with ca, edo, la3, zn

Details for d3ljta1

PDB Entry: 3ljt (more details), 1.6 Å

PDB Description: crystal structure of the catalytic domain of adamts-5 in complex with an amino-2-indanol compound
PDB Compounds: (A:) A disintegrin and metalloproteinase with thrombospondin motifs 5

SCOPe Domain Sequences for d3ljta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ljta1 d.92.1.0 (A:264-480) automated matches {Human (Homo sapiens) [TaxId: 9606]}
srarqvelllvadasmarkygrglqhylltlasianrlyshasienhirlavvkvvvlgd
kdkslevsknaattlknfckwqhqhnqlgddheehydaailftredlcghhscdtlgmad
vgticsperscavieddglhaaftvaheighllglshddskfceetfgstedkrlmssil
tsidaskpwskctsatiteflddghgnclldlprkqi

SCOPe Domain Coordinates for d3ljta1:

Click to download the PDB-style file with coordinates for d3ljta1.
(The format of our PDB-style files is described here.)

Timeline for d3ljta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ljta2