Lineage for d3liza1 (3liz A:-4-328)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2067626Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2067627Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2070410Family b.50.1.0: automated matches [191552] (1 protein)
    not a true family
  6. 2070411Protein automated matches [190954] (11 species)
    not a true protein
  7. 2070412Species Blattella germanica [TaxId:6973] [189570] (4 PDB entries)
  8. 2070414Domain d3liza1: 3liz A:-4-328 [180316]
    Other proteins in same PDB: d3liza2, d3lizl1, d3lizl2
    automated match to d1cmsa_
    complexed with cd, edo, nag, zn

Details for d3liza1

PDB Entry: 3liz (more details), 1.8 Å

PDB Description: crystal structure of bla g 2 complexed with fab 4c3
PDB Compounds: (A:) Aspartic protease Bla g 2

SCOPe Domain Sequences for d3liza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3liza1 b.50.1.0 (A:-4-328) automated matches {Blattella germanica [TaxId: 6973]}
vplyklvhvfintqyagitkignqnfltvfdstscnvvvasqecvggacvcpnlqkyekl
kpkyisdgnvqvkffdtgsavgrgiedsltisqlttsqqdivladelsqevcilsadvvv
giaapgcpnalkgktvlenfveenliapvfsihharfqdgehfgeiifggsdwkyvdgef
tyvplvgddswkfrldgvkigdttvapagtqaiidtskaiivgpkayvnpineaigcvve
ktttrrickldcskipslpdvtfvingrnfnissqyyiqqngnlcysgfqpcghsdhffi
gdffvdhyysefnwenktmgfgrsves

SCOPe Domain Coordinates for d3liza1:

Click to download the PDB-style file with coordinates for d3liza1.
(The format of our PDB-style files is described here.)

Timeline for d3liza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3liza2