Class b: All beta proteins [48724] (177 folds) |
Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
Superfamily b.50.1: Acid proteases [50630] (4 families) |
Family b.50.1.0: automated matches [191552] (1 protein) not a true family |
Protein automated matches [190954] (11 species) not a true protein |
Species Blattella germanica [TaxId:6973] [189570] (4 PDB entries) |
Domain d3liza1: 3liz A:-4-328 [180316] Other proteins in same PDB: d3liza2, d3lizl1, d3lizl2 automated match to d1cmsa_ complexed with cd, edo, nag, zn |
PDB Entry: 3liz (more details), 1.8 Å
SCOPe Domain Sequences for d3liza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3liza1 b.50.1.0 (A:-4-328) automated matches {Blattella germanica [TaxId: 6973]} vplyklvhvfintqyagitkignqnfltvfdstscnvvvasqecvggacvcpnlqkyekl kpkyisdgnvqvkffdtgsavgrgiedsltisqlttsqqdivladelsqevcilsadvvv giaapgcpnalkgktvlenfveenliapvfsihharfqdgehfgeiifggsdwkyvdgef tyvplvgddswkfrldgvkigdttvapagtqaiidtskaiivgpkayvnpineaigcvve ktttrrickldcskipslpdvtfvingrnfnissqyyiqqngnlcysgfqpcghsdhffi gdffvdhyysefnwenktmgfgrsves
Timeline for d3liza1: