Lineage for d9icja1 (9icj A:9-91)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 282277Fold a.60: SAM domain-like [47768] (13 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 282385Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (1 family) (S)
    contains one classic and one pseudo HhH motifs
  5. 282386Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (2 proteins)
  6. 282387Protein DNA polymerase beta, N-terminal (8 kD)-domain [47804] (2 species)
    topologically similar to the second domain
  7. 282388Species Human (Homo sapiens) [TaxId:9606] [47805] (92 PDB entries)
  8. 282441Domain d9icja1: 9icj A:9-91 [18030]
    Other proteins in same PDB: d9icja3, d9icja4
    protein/DNA complex; complexed with na, so4

Details for d9icja1

PDB Entry: 9icj (more details), 3.1 Å

PDB Description: dna polymerase beta (pol b) (e.c.2.7.7.7) complexed with seven base pairs of dna

SCOP Domain Sequences for d9icja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d9icja1 a.60.6.1 (A:9-91) DNA polymerase beta, N-terminal (8 kD)-domain {Human (Homo sapiens)}
etlnggitdmltelanfeknvsqaihkynayrkaasviakyphkiksgaeakklpgvgtk
iaekideflatgklrklekirqd

SCOP Domain Coordinates for d9icja1:

Click to download the PDB-style file with coordinates for d9icja1.
(The format of our PDB-style files is described here.)

Timeline for d9icja1: