SCOPe 2.06: Domain d3lg7a1: 3lg7 A:0-124

Lineage for d3lg7a1 (3lg7 A:0-124)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.47: STAT-like [47654] (6 superfamilies)
   4 long helices; bundle, left-handed twist (coiled coil); right-handed superhelix

4. Superfamily a.47.2: t-snare proteins [47661] (1 family)

5. Family a.47.2.1: t-snare proteins [47662] (6 proteins)

6. Protein automated matches [191190] (4 species)
   not a true protein

7. Species Artificial gene [TaxId:32630] [189472] (1 PDB entry)

8. Domain d3lg7a1: 3lg7 A:0-124 [180271]
   Other proteins in same PDB: d3lg7a2, d3lg7b2, d3lg7c2
   automated match to d1ez3a_
   complexed with so4

Details for d3lg7a1

PDB Entry: 3lg7, 2.5 Å

PDB Description: Crystal structure of HIV epitope-scaffold 4E10_S0_1EZ3A_002_C

PDB Compounds: (A:) 4e10_s0_1ez3a_002_c (t246)

SCOPe Domain Sequences for d3lg7a1:

Sequence, based on SEQRES records:

>d3lg7a1 a.47.2.1 (A:0-124) automated matches {Artificial gene [TaxId: 32630]}
mrdkfmdeffkqveeirqyidriaenveevarqhqailaspnpnwfdisqllwlmadike
tanevrkklkeieqsieqeegknkssadlkirkrqheelerkfrevmkeynatqqdyrkr
arkrn

Sequence, based on observed residues (ATOM records):

>d3lg7a1 a.47.2.1 (A:0-124) automated matches {Artificial gene [TaxId: 32630]}
mrdkfmdeffkqveeirqyidriaenveevarqhqailaspnpnwfdisqllwlmadike
tanevrkklkeieqsieqeekssadlkirkrqheelerkfrevmkeynatqqdyrkrark
rn

Timeline for d3lg7a1:

• d3lg7a1 first appeared in SCOPe 2.01, called d3lg7a_
  
• d3lg7a1 was called d3lg7a_ in SCOPe 2.05
  
• d3lg7a1 appears in SCOPe 2.07
  
• d3lg7a1 appears in the current release, SCOPe 2.08