Lineage for d9icfa1 (9icf A:9-91)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 642790Fold a.60: SAM domain-like [47768] (15 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 643019Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (1 family) (S)
    contains one classic and one pseudo HhH motifs
  5. 643020Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins)
  6. 643021Protein DNA polymerase beta, N-terminal (8 kD)-domain [47804] (2 species)
    topologically similar to the second domain
  7. 643022Species Human (Homo sapiens) [TaxId:9606] [47805] (103 PDB entries)
  8. 643094Domain d9icfa1: 9icf A:9-91 [18027]
    Other proteins in same PDB: d9icfa3, d9icfa4
    protein/DNA complex; complexed with dtp, na, zn

Details for d9icfa1

PDB Entry: 9icf (more details), 3 Å

PDB Description: dna polymerase beta (e.c.2.7.7.7)/dna complex + 2'-deoxyadenosine-5'-triphosphate, soaked in the presence of datp and zncl2
PDB Compounds: (A:) protein (DNA polymerase beta (e.c.2.7.7.7))

SCOP Domain Sequences for d9icfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d9icfa1 a.60.6.1 (A:9-91) DNA polymerase beta, N-terminal (8 kD)-domain {Human (Homo sapiens) [TaxId: 9606]}
etlnggitdmltelanfeknvsqaihkynayrkaasviakyphkiksgaeakklpgvgtk
iaekideflatgklrklekirqd

SCOP Domain Coordinates for d9icfa1:

Click to download the PDB-style file with coordinates for d9icfa1.
(The format of our PDB-style files is described here.)

Timeline for d9icfa1: