SCOP 1.73: Domain d9icaa1: 9ica A:9-91

Lineage for d9icaa1 (9ica A:9-91)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.60: SAM domain-like [47768] (15 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (1 family)
   contains one classic and one pseudo HhH motifs

5. Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins)

6. Protein DNA polymerase beta, N-terminal (8 kD)-domain [47804] (2 species)
   topologically similar to the second domain

7. Species Human (Homo sapiens) [TaxId:9606] [47805] (103 PDB entries)

8. Domain d9icaa1: 9ica A:9-91 [18026]
   Other proteins in same PDB: d9icaa3, d9icaa4
   protein/DNA complex; complexed with mn, stp

Details for d9icaa1

PDB Entry: 9ica, 3 Å

PDB Description: dna polymerase beta (e.c.2.7.7.7)/dna complex + 2'-deoxyadenosine-5'-o-(1-thiotriphosphate), soaked in the presence of datp(alpha)s and mncl2

PDB Compounds: (A:) protein (DNA polymerase beta (e.c.2.7.7.7))

SCOP Domain Sequences for d9icaa1:

Sequence; same for both SEQRES and ATOM records:

>d9icaa1 a.60.6.1 (A:9-91) DNA polymerase beta, N-terminal (8 kD)-domain {Human (Homo sapiens) [TaxId: 9606]}
etlnggitdmltelanfeknvsqaihkynayrkaasviakyphkiksgaeakklpgvgtk
iaekideflatgklrklekirqd

Timeline for d9icaa1:

• d9icaa1 first appeared (with stable ids) in SCOP 1.55
  
• d9icaa1 appears in SCOP 1.71
  
• d9icaa1 appears in SCOP 1.75
  
• d9icaa1 appears in the current release, SCOPe 2.08