Lineage for d3lfga_ (3lfg A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1035733Fold d.94: HPr-like [55593] (2 superfamilies)
    beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423
  4. 1035734Superfamily d.94.1: HPr-like [55594] (2 families) (S)
  5. 1035802Family d.94.1.0: automated matches [191653] (1 protein)
    not a true family
  6. 1035803Protein automated matches [191210] (1 species)
    not a true protein
  7. 1035804Species Thermoanaerobacter tengcongensis [TaxId:273068] [189569] (5 PDB entries)
  8. 1035805Domain d3lfga_: 3lfg A: [180251]
    automated match to d1mo1a_

Details for d3lfga_

PDB Entry: 3lfg (more details), 1.58 Å

PDB Description: Crystal structure of HPr-C-His from Thermoanaerobacter tengcongensis
PDB Compounds: (A:) Phosphotransferase system, HPr-related proteins

SCOPe Domain Sequences for d3lfga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lfga_ d.94.1.0 (A:) automated matches {Thermoanaerobacter tengcongensis [TaxId: 273068]}
mkevtieiknktglharpaalfvqtaskfssqiwvekdnkkvnaksimgimslgvsqgnv
vklsaegddeeeaikalvdlieskfgee

SCOPe Domain Coordinates for d3lfga_:

Click to download the PDB-style file with coordinates for d3lfga_.
(The format of our PDB-style files is described here.)

Timeline for d3lfga_: