![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.94: HPr-like [55593] (2 superfamilies) beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423 |
![]() | Superfamily d.94.1: HPr-like [55594] (2 families) ![]() |
![]() | Family d.94.1.0: automated matches [191653] (1 protein) not a true family |
![]() | Protein automated matches [191210] (2 species) not a true protein |
![]() | Species Thermoanaerobacter tengcongensis [TaxId:273068] [189569] (5 PDB entries) |
![]() | Domain d3lfga_: 3lfg A: [180251] Other proteins in same PDB: d3lfgb2 automated match to d1mo1a_ |
PDB Entry: 3lfg (more details), 1.58 Å
SCOPe Domain Sequences for d3lfga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lfga_ d.94.1.0 (A:) automated matches {Thermoanaerobacter tengcongensis [TaxId: 273068]} mkevtieiknktglharpaalfvqtaskfssqiwvekdnkkvnaksimgimslgvsqgnv vklsaegddeeeaikalvdlieskfgee
Timeline for d3lfga_: