Lineage for d3leza_ (3lez A:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3012718Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 3012719Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 3012720Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
    in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
  6. 3013567Protein automated matches [190161] (29 species)
    not a true protein
  7. 3013917Species Oceanobacillus iheyensis [TaxId:182710] [189232] (1 PDB entry)
  8. 3013918Domain d3leza_: 3lez A: [180239]
    automated match to d1i2sa_
    complexed with ca, cl, epe

Details for d3leza_

PDB Entry: 3lez (more details), 1.25 Å

PDB Description: Crystal structure of a halotolerant bacterial beta-lactamase
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d3leza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3leza_ e.3.1.1 (A:) automated matches {Oceanobacillus iheyensis [TaxId: 182710]}
gsedlkkleeefdvrlgvyaidtgadkeisyrenerfaytstfkplavgavlqtksdeel
eetityseedlvtyspiteqhvdegmtlveiadaairysdntagnllleamggpdeleti
lrdigdetiemdryetelneakpgdirdtstakamattlqqyvledvldadrrevltnml
innttgdaliragvpdgwtvgdktgaggygtrndigiiwpegdeepiviaimssrdeeda
dyddkliekateivlqelrn

SCOPe Domain Coordinates for d3leza_:

Click to download the PDB-style file with coordinates for d3leza_.
(The format of our PDB-style files is described here.)

Timeline for d3leza_: