SCOPe 2.08: Domain d3lerb_: 3ler B:

Lineage for d3lerb_ (3ler B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.1: Class I aldolase [51570] (13 proteins)
   the catalytic lysine forms schiff-base intermediate with substrate
   possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels

6. Protein Dihydrodipicolinate synthase [51574] (13 species)

7. Species Campylobacter jejuni [TaxId:192222] [189204] (3 PDB entries)

8. Domain d3lerb_: 3ler B: [180236]
   automated match to d1o5ka_
   complexed with acy, edo, fmt, mg, peg
   has additional insertions and/or extensions that are not grouped together

Details for d3lerb_

PDB Entry: 3ler, 1.84 Å

PDB Description: crystal structure of dihydrodipicolinate synthase from campylobacter jejuni subsp. jejuni nctc 11168

PDB Compounds: (B:) Dihydrodipicolinate synthase

SCOPe Domain Sequences for d3lerb_:

Sequence; same for both SEQRES and ATOM records:

>d3lerb_ c.1.10.1 (B:) Dihydrodipicolinate synthase {Campylobacter jejuni [TaxId: 192222]}
mdkniiigamtalitpfkngkvdeqsyarlikrqiengidavvpvgttgesatltheehr
tcieiavetckgtkvkvlagagsnatheavglakfakehgadgilsvapyynkptqqgly
ehykaiaqsvdipvllynvpgrtgceistdtiiklfrdceniygvxeasgnidkcvdlla
heprmmlisgedainypilsnggkgvisvtsnllpdmisalthfaldenykeakkindel
yninkilfcesnpipiktamylaglieslefrlplcspskenfakieevmkkykikgf

Timeline for d3lerb_:

• d3lerb_ first appeared in SCOPe 2.01
  
• d3lerb_ appears in SCOPe 2.07