![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
![]() | Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
![]() | Protein automated matches [190770] (37 species) not a true protein |
![]() | Species Streptococcus mitis [TaxId:28037] [189586] (6 PDB entries) |
![]() | Domain d3leka_: 3lek A: [180228] automated match to d1k12a_ complexed with bcw, ca, ni |
PDB Entry: 3lek (more details), 2 Å
SCOPe Domain Sequences for d3leka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3leka_ b.18.1.0 (A:) automated matches {Streptococcus mitis [TaxId: 28037]} veteniargkqasqsstayggaatravdgnvdsdyghhsvthtnfednawwqvdlgkten vgkvklynrgdgnvanrlsnfdvvllneakqevarqhfdslngkaelevfftakdaryvk velktkntplslaevevfrsa
Timeline for d3leka_: