Lineage for d3leia_ (3lei A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 942101Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 942102Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families) (S)
  5. 942722Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 942723Protein automated matches [190770] (6 species)
    not a true protein
  7. 942755Species Streptococcus mitis [TaxId:28037] [189586] (4 PDB entries)
  8. 942757Domain d3leia_: 3lei A: [180227]
    automated match to d1k12a_
    complexed with ca, fuc, ni

Details for d3leia_

PDB Entry: 3lei (more details), 1.9 Å

PDB Description: Lectin Domain of Lectinolysin complexed with Fucose
PDB Compounds: (A:) Platelet aggregation factor Sm-hPAF

SCOPe Domain Sequences for d3leia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3leia_ b.18.1.0 (A:) automated matches {Streptococcus mitis [TaxId: 28037]}
pveteniargkqasqsstayggaatravdgnvdsdyghhsvthtnfednawwqvdlgkte
nvgkvklynrgdgnvanrlsnfdvvllneakqevarqhfdslngkaelevfftakdaryv
kvelktkntplslaevevfrsat

SCOPe Domain Coordinates for d3leia_:

Click to download the PDB-style file with coordinates for d3leia_.
(The format of our PDB-style files is described here.)

Timeline for d3leia_: