SCOPe 2.05: Domain d3lcec_: 3lce C:

Lineage for d3lcec_ (3lce C:)

1. Root: SCOPe 2.05

2. Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein Class D beta-lactamase [56622] (4 species)

7. Species Pseudomonas aeruginosa, OXA-10 [TaxId:287] [56623] (27 PDB entries)

8. Domain d3lcec_: 3lce C: [180182]
   automated match to d1e4dc_
   complexed with gol, lce, po4

Details for d3lcec_

PDB Entry: 3lce, 2 Å

PDB Description: Crystal Structure of Oxa-10 Beta-Lactamase Covalently Bound to Cyclobutanone Beta-Lactam Mimic

PDB Compounds: (C:) beta-lactamase oxa-10

SCOPe Domain Sequences for d3lcec_:

Sequence; same for both SEQRES and ATOM records:

>d3lcec_ e.3.1.1 (C:) Class D beta-lactamase {Pseudomonas aeruginosa, OXA-10 [TaxId: 287]}
sitentswnkefsaeavngvfvlckssskscatndlaraskeylpastfkipnaiiglet
gviknehqvfkwdgkpramkqwerdltlrgaiqvsavpvfqqiarevgevrmqkylkkfs
ygnqnisggidkfwlegqlrisavnqvefleslylnklsaskenqlivkealvteaapey
lvhsktgfsgvgtesnpgvawwvgwveketevyffafnmdidnesklplrksiptkimes
egiigg

Timeline for d3lcec_:

• d3lcec_ first appeared in SCOPe 2.01
  
• d3lcec_ appears in SCOPe 2.04
  
• d3lcec_ appears in SCOPe 2.06
  
• d3lcec_ appears in the current release, SCOPe 2.08