Lineage for d3lceb_ (3lce B:)

  1. Root: SCOPe 2.04
  2. 1689992Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1690252Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1690253Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1690254Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1690658Protein Class D beta-lactamase [56622] (4 species)
  7. 1690668Species Pseudomonas aeruginosa, OXA-10 [TaxId:287] [56623] (25 PDB entries)
  8. 1690708Domain d3lceb_: 3lce B: [180181]
    automated match to d1e4dc_
    complexed with gol, lce, po4

Details for d3lceb_

PDB Entry: 3lce (more details), 2 Å

PDB Description: Crystal Structure of Oxa-10 Beta-Lactamase Covalently Bound to Cyclobutanone Beta-Lactam Mimic
PDB Compounds: (B:) beta-lactamase oxa-10

SCOPe Domain Sequences for d3lceb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lceb_ e.3.1.1 (B:) Class D beta-lactamase {Pseudomonas aeruginosa, OXA-10 [TaxId: 287]}
sitentswnkefsaeavngvfvlckssskscatndlaraskeylpastfkipnaiiglet
gviknehqvfkwdgkpramkqwerdltlrgaiqvsavpvfqqiarevgevrmqkylkkfs
ygnqnisggidkfwlegqlrisavnqvefleslylnklsaskenqlivkealvteaapey
lvhsktgfsgvgtesnpgvawwvgwveketevyffafnmdidnesklplrksiptkimes
egiig

SCOPe Domain Coordinates for d3lceb_:

Click to download the PDB-style file with coordinates for d3lceb_.
(The format of our PDB-style files is described here.)

Timeline for d3lceb_: