Class b: All beta proteins [48724] (176 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins) |
Protein Coagulation factor IXa, protease domain [50583] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [50585] (5 PDB entries) |
Domain d3lc3c_: 3lc3 C: [180173] Other proteins in same PDB: d3lc3b_, d3lc3d_ automated match to d1rfna_ complexed with ca, iyx |
PDB Entry: 3lc3 (more details), 1.9 Å
SCOPe Domain Sequences for d3lc3c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lc3c_ b.47.1.2 (C:) Coagulation factor IXa, protease domain {Human (Homo sapiens) [TaxId: 9606]} vvggedakpgqfpwqvvlngkvdafcggsivnekwivtaahcvetgvkitvvagehniee tehteqkrnviriiphhnynaainkynhdialleldeplvlnsyvtpiciadkeytnifl kfgsgyvsgwgrvfhkgrsalvlqylrvplvdratclrstkftiynnmfcagfheggrds cqgdsggphvtevegtsfltgiiswgeecamkgkygiytkvsryvnwikektklt
Timeline for d3lc3c_: