Lineage for d7icga1 (7icg A:9-91)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 356779Fold a.60: SAM domain-like [47768] (13 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 356901Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (1 family) (S)
    contains one classic and one pseudo HhH motifs
  5. 356902Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins)
  6. 356903Protein DNA polymerase beta, N-terminal (8 kD)-domain [47804] (2 species)
    topologically similar to the second domain
  7. 356904Species Human (Homo sapiens) [TaxId:9606] [47805] (92 PDB entries)
  8. 356937Domain d7icga1: 7icg A:9-91 [18017]
    Other proteins in same PDB: d7icga3, d7icga4
    protein/DNA complex; complexed with na

Details for d7icga1

PDB Entry: 7icg (more details), 3 Å

PDB Description: dna polymerase beta (e.c.2.7.7.7)/dna complex, soaked in the presence of cdcl2

SCOP Domain Sequences for d7icga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7icga1 a.60.6.1 (A:9-91) DNA polymerase beta, N-terminal (8 kD)-domain {Human (Homo sapiens)}
etlnggitdmltelanfeknvsqaihkynayrkaasviakyphkiksgaeakklpgvgtk
iaekideflatgklrklekirqd

SCOP Domain Coordinates for d7icga1:

Click to download the PDB-style file with coordinates for d7icga1.
(The format of our PDB-style files is described here.)

Timeline for d7icga1: