Lineage for d3lbza_ (3lbz A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1202046Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 1202047Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 1202048Family d.42.1.1: BTB/POZ domain [54696] (5 proteins)
  6. 1202049Protein B-cell lymphoma 6 (Bcl6) protein BTB domain [102922] (1 species)
  7. 1202050Species Human (Homo sapiens) [TaxId:9606] [102923] (6 PDB entries)
  8. 1202062Domain d3lbza_: 3lbz A: [180169]
    automated match to d1r2ba_
    complexed with z88, z89

Details for d3lbza_

PDB Entry: 3lbz (more details), 2.3 Å

PDB Description: crystal structure of the bcl6 btb domain complexed with the small molecule inhibitor 79-6
PDB Compounds: (A:) B-cell lymphoma 6 protein

SCOPe Domain Sequences for d3lbza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lbza_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]}
sqiqftrhasdvllnlnrlrsrdiltdvvivvsreqfrahktvlmacsglfysiftdqlk
rnlsvinldpeinpegfnilldfmytsrlnlregnimavmatamylqmehvvdtcrkfik
as

SCOPe Domain Coordinates for d3lbza_:

Click to download the PDB-style file with coordinates for d3lbza_.
(The format of our PDB-style files is described here.)

Timeline for d3lbza_: