SCOPe 2.01: Domain d3lb3b_: 3lb3 B:

Lineage for d3lb3b_ (3lb3 B:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Dehaloperoxidase [46530] (1 species)

7. Species Amphitrite ornata [TaxId:129555] [46531] (16 PDB entries)

8. Domain d3lb3b_: 3lb3 B: [180155]
   automated match to d1ew6a_
   complexed with 4ch, hem, so4

Details for d3lb3b_

PDB Entry: 3lb3, 1.85 Å

PDB Description: Two-site competitive inhibition in dehaloperoxidase-hemoglobin

PDB Compounds: (B:) Dehaloperoxidase A

SCOPe Domain Sequences for d3lb3b_:

Sequence; same for both SEQRES and ATOM records:

>d3lb3b_ a.1.1.2 (B:) Dehaloperoxidase {Amphitrite ornata [TaxId: 129555]}
gfkqdiatirgdlrtyaqdiflaflnkypderryfknyvgksdqelksmakfgdhtekvf
nlmmevadratdcvplasdantlvqmkqhsslttgnfeklfvalveymrasgqsfdsqsw
drfgknlvsalssagmk

Timeline for d3lb3b_:

• d3lb3b_ is new in SCOPe 2.01-stable
  
• d3lb3b_ appears in SCOPe 2.02
  
• d3lb3b_ appears in the current release, SCOPe 2.08