SCOPe 2.02: Domain d3l9la_: 3l9l A:

Lineage for d3l9la_ (3l9l A:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein cAMP-dependent PK, catalytic subunit [56116] (4 species)
   AGC group; PKA subfamily; serine/threonine kinase

7. Species Pig (Sus scrofa) [TaxId:9823] [56117] (9 PDB entries)

8. Domain d3l9la_: 3l9l A: [180118]
   automated match to d1cmke_
   complexed with l9l

Details for d3l9la_

PDB Entry: 3l9l, 2 Å

PDB Description: Crystal structure of pka with compound 36

PDB Compounds: (A:) cAMP-dependent protein kinase catalytic subunit alpha

SCOPe Domain Sequences for d3l9la_:

Sequence; same for both SEQRES and ATOM records:

>d3l9la_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Pig (Sus scrofa) [TaxId: 9823]}
eqesvkeflakakedflkkwespaqntahldqferiktlgtgsfgrvmlvkhketgnhya
mkildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvpggemfs
hlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfgfakr
vkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqiyeki
vsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiyqrkv
eapfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef

Timeline for d3l9la_:

• d3l9la_ first appeared in SCOPe 2.01
  
• d3l9la_ appears in SCOPe 2.03
  
• d3l9la_ appears in the current release, SCOPe 2.08