Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
Protein automated matches [190329] (10 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187151] (10 PDB entries) |
Domain d3l9jc_: 3l9j C: [180116] Other proteins in same PDB: d3l9jt_ automated match to d1tn3a_ complexed with mg |
PDB Entry: 3l9j (more details), 2.1 Å
SCOPe Domain Sequences for d3l9jc_:
Sequence, based on SEQRES records: (download)
>d3l9jc_ d.169.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} lqtvclkgtkhmkcflaftqtktfheasedcisrggtlstpqtgsendalyeylrqsvgn eaeiwlglnkrwsryfwvdmtgtriayknwehssdaqpdpsnwencavlsgaangkwfgk rcrdqlpyicqfgi
>d3l9jc_ d.169.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} lqtvclhmkcflaftqtktfheasedcisrggtlstpqtgsendalyeylrqsvgneaei wlglnkrwsryfwvdmtgtriayknwehssdaqpdpsnwencavlsgaangkwfgkrcrd qlpyicqfgi
Timeline for d3l9jc_: