SCOPe 2.06: Domain d3l9eb_: 3l9e B:

Lineage for d3l9eb_ (3l9e B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families)
   has additional strand at N-terminus

5. Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)

6. Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species)

7. Species Silkworm (Bombyx mori) [TaxId:7091] [189285] (2 PDB entries)

8. Domain d3l9eb_: 3l9e B: [180110]
   automated match to d1to4a_
   complexed with zn

Details for d3l9eb_

PDB Entry: 3l9e, 2.05 Å

PDB Description: Crystal structures of holo and Cu-deficient Cu/ZnSOD from the silkworm Bombyx mori and the implications in Amyotrophic lateral sclerosis

PDB Compounds: (B:) Superoxide dismutase [Cu-Zn]

SCOPe Domain Sequences for d3l9eb_:

Sequence; same for both SEQRES and ATOM records:

>d3l9eb_ b.1.8.1 (B:) Cu,Zn superoxide dismutase, SOD {Silkworm (Bombyx mori) [TaxId: 7091]}
mpakavcvlrgdvsgtvffdqqdekspvvvsgevqgltkgkhgfhvhefgdntngctsag
ahfnpekqdhggpssavrhvgdlgnieaiedsgvtkvsiqdsqislhgpnsiigrtlvvh
adpddlglgghelskttgnaggriacgviglaki

Timeline for d3l9eb_:

• d3l9eb_ first appeared in SCOPe 2.01
  
• d3l9eb_ appears in SCOPe 2.05
  
• d3l9eb_ appears in SCOPe 2.07
  
• d3l9eb_ appears in the current release, SCOPe 2.08