Lineage for d3l92a_ (3l92 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2860045Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2860373Family c.26.1.3: Adenylyltransferase [52397] (6 proteins)
  6. 2860573Protein automated matches [190964] (6 species)
    not a true protein
  7. 2860639Species Yersinia pestis [TaxId:214092] [189196] (2 PDB entries)
  8. 2860640Domain d3l92a_: 3l92 A: [180099]
    automated match to d1gn8a_
    complexed with coa

Details for d3l92a_

PDB Entry: 3l92 (more details), 1.89 Å

PDB Description: phosphopantetheine adenylyltransferase from yersinia pestis complexed with coenzyme a.
PDB Compounds: (A:) phosphopantetheine adenylyltransferase

SCOPe Domain Sequences for d3l92a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l92a_ c.26.1.3 (A:) automated matches {Yersinia pestis [TaxId: 214092]}
mitkaiypgtfdpitnghldlvtrasamfshvilaiadssskkpmftldervalakkvta
plknvevlgfselmaefakkhnanilvrglrsvsdfeyewqlanmnrhlmpklesvflip
sekwsfissslvkevarhggditpflpkpvtkallakla

SCOPe Domain Coordinates for d3l92a_:

Click to download the PDB-style file with coordinates for d3l92a_.
(The format of our PDB-style files is described here.)

Timeline for d3l92a_: