Lineage for d3l7wa_ (3l7w A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694554Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2694555Protein automated matches [190154] (92 species)
    not a true protein
  7. 2695115Species Streptococcus mutans [TaxId:210007] [189554] (1 PDB entry)
  8. 2695116Domain d3l7wa_: 3l7w A: [180067]
    automated match to d1xmaa_

Details for d3l7wa_

PDB Entry: 3l7w (more details), 2.2 Å

PDB Description: The Crystal Structure of smu.1704 from Streptococcus mutans UA159
PDB Compounds: (A:) Putative uncharacterized protein SMU.1704

SCOPe Domain Sequences for d3l7wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l7wa_ a.4.5.0 (A:) automated matches {Streptococcus mutans [TaxId: 210007]}
myypvsallieylilaivskhdsygydisqtikliasikestlypilkklekagylstyt
qehqgrrrkyyhltdsgekhlvyltkewsvykmtidgivegrirhd

SCOPe Domain Coordinates for d3l7wa_:

Click to download the PDB-style file with coordinates for d3l7wa_.
(The format of our PDB-style files is described here.)

Timeline for d3l7wa_: