Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
Protein automated matches [190154] (92 species) not a true protein |
Species Streptococcus mutans [TaxId:210007] [189554] (1 PDB entry) |
Domain d3l7wa_: 3l7w A: [180067] automated match to d1xmaa_ |
PDB Entry: 3l7w (more details), 2.2 Å
SCOPe Domain Sequences for d3l7wa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l7wa_ a.4.5.0 (A:) automated matches {Streptococcus mutans [TaxId: 210007]} myypvsallieylilaivskhdsygydisqtikliasikestlypilkklekagylstyt qehqgrrrkyyhltdsgekhlvyltkewsvykmtidgivegrirhd
Timeline for d3l7wa_: