Lineage for d3l75g_ (3l75 G:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2253581Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2254451Superfamily f.23.13: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81508] (1 family) (S)
    automatically mapped to Pfam PF02939
  5. 2254452Family f.23.13.1: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81507] (2 proteins)
  6. 2254494Protein automated matches [191133] (1 species)
    not a true protein
  7. 2254495Species Chicken (Gallus gallus) [TaxId:9031] [189229] (8 PDB entries)
  8. 2254500Domain d3l75g_: 3l75 G: [180034]
    Other proteins in same PDB: d3l75a1, d3l75a2, d3l75b1, d3l75b2, d3l75c1, d3l75c2, d3l75d1, d3l75d2, d3l75e1, d3l75e2, d3l75f_, d3l75h_, d3l75j_, d3l75n1, d3l75n2, d3l75o1, d3l75o2, d3l75p1, d3l75p2, d3l75q1, d3l75q2, d3l75r1, d3l75r2, d3l75s_, d3l75u_, d3l75w_
    automated match to d1be3g_
    complexed with azi, bog, cdl, fes, fnm, hec, hem, pee, unl, uq

Details for d3l75g_

PDB Entry: 3l75 (more details), 2.79 Å

PDB Description: cytochrome bc1 complex from chicken with fenamidone bound
PDB Compounds: (G:) Mitochondrial ubiquinol-cytochrome c reductase ubiquinone-binding protein qp-c

SCOPe Domain Sequences for d3l75g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l75g_ f.23.13.1 (G:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
gihfgnlarvrhiityslspfeqraipnifsdalpnvwrrfssqvfkvappflgayllys
wgtqeferlkrknpadyendq

SCOPe Domain Coordinates for d3l75g_:

Click to download the PDB-style file with coordinates for d3l75g_.
(The format of our PDB-style files is described here.)

Timeline for d3l75g_: