Lineage for d3l74u_ (3l74 U:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2255712Fold f.28: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81532] (1 superfamily)
    membrane-associated alpha-helical protein; no transmembrane helices
  4. 2255713Superfamily f.28.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81531] (1 family) (S)
    location - intermembrane side of the bc1 complex
    automatically mapped to Pfam PF02320
  5. 2255714Family f.28.1.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81530] (2 proteins)
    "acidic/hinge protein", essential for the complex formation, interacts with the functional domain of cytochrome c1
  6. 2255745Protein automated matches [190042] (3 species)
    not a true protein
  7. 2255746Species Chicken (Gallus gallus) [TaxId:9031] [189230] (8 PDB entries)
  8. 2255754Domain d3l74u_: 3l74 U: [180031]
    Other proteins in same PDB: d3l74a1, d3l74a2, d3l74b1, d3l74b2, d3l74c1, d3l74c2, d3l74d1, d3l74d2, d3l74e1, d3l74e2, d3l74f_, d3l74g_, d3l74j_, d3l74n1, d3l74n2, d3l74o1, d3l74o2, d3l74p1, d3l74p2, d3l74q1, d3l74q2, d3l74r1, d3l74r2, d3l74s_, d3l74t_, d3l74w_
    automated match to d1bcch_
    complexed with azi, bog, cdl, fes, fmx, hec, hem, pee, unl, uq

Details for d3l74u_

PDB Entry: 3l74 (more details), 2.76 Å

PDB Description: cytochrome bc1 complex from chicken with famoxadone bound
PDB Compounds: (U:) Mitochondrial ubiquinol-cytochrome c reductase 11 kda protein, complex iii subunit viii

SCOPe Domain Sequences for d3l74u_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l74u_ f.28.1.1 (U:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
elvdplttirehceqtekcvkarerlelcdarvssrshteeqcteelfdflhardhcvah
klfnklk

SCOPe Domain Coordinates for d3l74u_:

Click to download the PDB-style file with coordinates for d3l74u_.
(The format of our PDB-style files is described here.)

Timeline for d3l74u_: