| Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
| Fold f.28: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81532] (1 superfamily) membrane-associated alpha-helical protein; no transmembrane helices |
Superfamily f.28.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81531] (1 family) ![]() location - intermembrane side of the bc1 complex |
| Family f.28.1.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81530] (2 proteins) "acidic/hinge protein", essential for the complex formation, interacts with the functional domain of cytochrome c1 |
| Protein automated matches [190042] (2 species) not a true protein |
| Species Chicken (Gallus gallus) [TaxId:9031] [189230] (4 PDB entries) |
| Domain d3l74u_: 3l74 U: [180031] Other proteins in same PDB: d3l74f_, d3l74g_, d3l74j_, d3l74s_, d3l74t_, d3l74w_ automated match to d1bcch_ complexed with azi, bog, cdl, fes, fmx, hec, hem, pee, unl, uq |
PDB Entry: 3l74 (more details), 2.76 Å
SCOPe Domain Sequences for d3l74u_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l74u_ f.28.1.1 (U:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
elvdplttirehceqtekcvkarerlelcdarvssrshteeqcteelfdflhardhcvah
klfnklk
Timeline for d3l74u_: