Lineage for d7icta1 (7ict A:9-91)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 98579Fold a.60: SAM domain-like [47768] (11 superfamilies)
  4. 98661Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (1 family) (S)
  5. 98662Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (2 proteins)
  6. 98663Protein DNA polymerase beta, N-terminal (8 kD)-domain [47804] (2 species)
  7. 98664Species Human (Homo sapiens) [TaxId:9606] [47805] (90 PDB entries)
  8. 98685Domain d7icta1: 7ict A:9-91 [18003]
    Other proteins in same PDB: d7icta2

Details for d7icta1

PDB Entry: 7ict (more details), 2.8 Å

PDB Description: dna polymerase beta (e.c.2.7.7.7)/dna complex, soaked in the presence of zncl2 and mgcl2

SCOP Domain Sequences for d7icta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7icta1 a.60.6.1 (A:9-91) DNA polymerase beta, N-terminal (8 kD)-domain {Human (Homo sapiens)}
etlnggitdmltelanfeknvsqaihkynayrkaasviakyphkiksgaeakklpgvgtk
iaekideflatgklrklekirqd

SCOP Domain Coordinates for d7icta1:

Click to download the PDB-style file with coordinates for d7icta1.
(The format of our PDB-style files is described here.)

Timeline for d7icta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d7icta2