Lineage for d3l74s_ (3l74 S:)

  1. Root: SCOPe 2.03
  2. 1454900Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1458053Fold f.27: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81525] (1 superfamily)
    membrane-associated alpha-helical protein; no transmembrane helices
  4. 1458054Superfamily f.27.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81524] (1 family) (S)
    location - matrix side of the bc1 complex
    automatically mapped to Pfam PF02271
  5. 1458055Family f.27.1.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81523] (2 proteins)
    probably important for the complex assembly, caps the matrix face of cytochrome b
  6. 1458085Protein automated matches [190325] (4 species)
    not a true protein
  7. 1458093Species Chicken (Gallus gallus) [TaxId:9031] [189228] (4 PDB entries)
  8. 1458097Domain d3l74s_: 3l74 S: [180029]
    Other proteins in same PDB: d3l74c1, d3l74c2, d3l74g_, d3l74h_, d3l74j_, d3l74p1, d3l74p2, d3l74t_, d3l74u_, d3l74w_
    automated match to d1sqpf1
    complexed with azi, bog, cdl, fes, fmx, hec, hem, pee, unl, uq

Details for d3l74s_

PDB Entry: 3l74 (more details), 2.76 Å

PDB Description: cytochrome bc1 complex from chicken with famoxadone bound
PDB Compounds: (S:) Mitochondrial ubiquinol-cytochrome c reductase 14 kda protein

SCOPe Domain Sequences for d3l74s_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l74s_ f.27.1.1 (S:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
grlmdrirkwyynaagfnkyglmrddtlyedddvkealkrlpedlynermfrikraldls
lkhrilpkeqwvkyeedkpylepylkevirerlereawnkk

SCOPe Domain Coordinates for d3l74s_:

Click to download the PDB-style file with coordinates for d3l74s_.
(The format of our PDB-style files is described here.)

Timeline for d3l74s_: