Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.27: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81525] (1 superfamily) membrane-associated alpha-helical protein; no transmembrane helices |
Superfamily f.27.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81524] (1 family) location - matrix side of the bc1 complex automatically mapped to Pfam PF02271 |
Family f.27.1.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81523] (2 proteins) probably important for the complex assembly, caps the matrix face of cytochrome b |
Protein automated matches [190325] (4 species) not a true protein |
Species Chicken (Gallus gallus) [TaxId:9031] [189228] (4 PDB entries) |
Domain d3l74s_: 3l74 S: [180029] Other proteins in same PDB: d3l74c1, d3l74c2, d3l74g_, d3l74h_, d3l74j_, d3l74p1, d3l74p2, d3l74t_, d3l74u_, d3l74w_ automated match to d1sqpf1 complexed with azi, bog, cdl, fes, fmx, hec, hem, pee, unl, uq |
PDB Entry: 3l74 (more details), 2.76 Å
SCOPe Domain Sequences for d3l74s_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l74s_ f.27.1.1 (S:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} grlmdrirkwyynaagfnkyglmrddtlyedddvkealkrlpedlynermfrikraldls lkhrilpkeqwvkyeedkpylepylkevirerlereawnkk
Timeline for d3l74s_: