Lineage for d3l74j_ (3l74 J:)

  1. Root: SCOPe 2.04
  2. 1695624Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1697651Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 1698406Superfamily f.23.14: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81514] (1 family) (S)
    automatically mapped to Pfam PF05365
  5. 1698407Family f.23.14.1: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81513] (2 proteins)
  6. 1698442Protein automated matches [190326] (3 species)
    not a true protein
  7. 1698451Species Chicken (Gallus gallus) [TaxId:9031] [189231] (8 PDB entries)
  8. 1698454Domain d3l74j_: 3l74 J: [180028]
    Other proteins in same PDB: d3l74a1, d3l74a2, d3l74b1, d3l74b2, d3l74c1, d3l74c2, d3l74d1, d3l74d2, d3l74f_, d3l74g_, d3l74h_, d3l74n1, d3l74n2, d3l74o1, d3l74o2, d3l74p1, d3l74p2, d3l74q1, d3l74q2, d3l74s_, d3l74t_, d3l74u_
    automated match to d1bccj_
    complexed with azi, bog, cdl, fes, fmx, hec, hem, pee, unl, uq

Details for d3l74j_

PDB Entry: 3l74 (more details), 2.76 Å

PDB Description: cytochrome bc1 complex from chicken with famoxadone bound
PDB Compounds: (J:) Mitochondrial ubiquinol-cytochrome c reductase 7.2 kda protein

SCOPe Domain Sequences for d3l74j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l74j_ f.23.14.1 (J:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
allrqaysalfrrtstfaltvvlgavlferafdqgadaifehlnegklwkhikhkyease
e

SCOPe Domain Coordinates for d3l74j_:

Click to download the PDB-style file with coordinates for d3l74j_.
(The format of our PDB-style files is described here.)

Timeline for d3l74j_: