SCOPe 2.08: Domain d3l74g_: 3l74 G:

Lineage for d3l74g_ (3l74 G:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.13: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81508] (1 family)
   automatically mapped to Pfam PF02939

5. Family f.23.13.1: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81507] (2 proteins)

6. Protein automated matches [191133] (1 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [189229] (8 PDB entries)

8. Domain d3l74g_: 3l74 G: [180026]
   Other proteins in same PDB: d3l74a1, d3l74a2, d3l74b1, d3l74b2, d3l74c1, d3l74c2, d3l74d1, d3l74d2, d3l74e1, d3l74e2, d3l74f_, d3l74h_, d3l74j_, d3l74n1, d3l74n2, d3l74o1, d3l74o2, d3l74p1, d3l74p2, d3l74q1, d3l74q2, d3l74r1, d3l74r2, d3l74s_, d3l74u_, d3l74w_
   automated match to d1be3g_
   complexed with azi, bog, cdl, fes, fmx, hec, hem, pee, unl, uq

Details for d3l74g_

PDB Entry: 3l74, 2.76 Å

PDB Description: cytochrome bc1 complex from chicken with famoxadone bound

PDB Compounds: (G:) Mitochondrial ubiquinol-cytochrome c reductase ubiquinone-binding protein qp-c

SCOPe Domain Sequences for d3l74g_:

Sequence; same for both SEQRES and ATOM records:

>d3l74g_ f.23.13.1 (G:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
gihfgnlarvrhiityslspfeqraipnifsdalpnvwrrfssqvfkvappflgayllys
wgtqeferlkrknpadyendq

Timeline for d3l74g_:

• d3l74g_ first appeared in SCOPe 2.01
  
• d3l74g_ appears in SCOPe 2.07