Lineage for d3l74f_ (3l74 F:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2632997Fold f.27: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81525] (1 superfamily)
    membrane-associated alpha-helical protein; no transmembrane helices
  4. 2632998Superfamily f.27.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81524] (1 family) (S)
    location - matrix side of the bc1 complex
    automatically mapped to Pfam PF02271
  5. 2632999Family f.27.1.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81523] (2 proteins)
    probably important for the complex assembly, caps the matrix face of cytochrome b
  6. 2633029Protein automated matches [190325] (4 species)
    not a true protein
  7. 2633042Species Chicken (Gallus gallus) [TaxId:9031] [189228] (8 PDB entries)
  8. 2633045Domain d3l74f_: 3l74 F: [180025]
    Other proteins in same PDB: d3l74a1, d3l74a2, d3l74b1, d3l74b2, d3l74c1, d3l74c2, d3l74d1, d3l74d2, d3l74e1, d3l74e2, d3l74g_, d3l74h_, d3l74j_, d3l74n1, d3l74n2, d3l74o1, d3l74o2, d3l74p1, d3l74p2, d3l74q1, d3l74q2, d3l74r1, d3l74r2, d3l74t_, d3l74u_, d3l74w_
    automated match to d1sqpf1
    complexed with azi, bog, cdl, fes, fmx, hec, hem, pee, unl, uq

Details for d3l74f_

PDB Entry: 3l74 (more details), 2.76 Å

PDB Description: cytochrome bc1 complex from chicken with famoxadone bound
PDB Compounds: (F:) Mitochondrial ubiquinol-cytochrome c reductase 14 kda protein

SCOPe Domain Sequences for d3l74f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l74f_ f.27.1.1 (F:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
grlmdrirkwyynaagfnkyglmrddtlyedddvkealkrlpedlynermfrikraldls
lkhrilpkeqwvkyeedkpylepylkevirerlereawnkk

SCOPe Domain Coordinates for d3l74f_:

Click to download the PDB-style file with coordinates for d3l74f_.
(The format of our PDB-style files is described here.)

Timeline for d3l74f_: