![]() | Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (38 superfamilies) not a true fold |
![]() | Superfamily f.23.14: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81514] (1 family) ![]() |
![]() | Family f.23.14.1: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81513] (2 proteins) |
![]() | Protein automated matches [190326] (3 species) not a true protein |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [189231] (4 PDB entries) |
![]() | Domain d3l71w_: 3l71 W: [180024] Other proteins in same PDB: d3l71f_, d3l71g_, d3l71h_, d3l71s_, d3l71t_, d3l71u_ automated match to d1bccj_ complexed with azo, bog, cdl, fes, gol, hec, hem, pee, uq |
PDB Entry: 3l71 (more details), 2.84 Å
SCOPe Domain Sequences for d3l71w_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l71w_ f.23.14.1 (W:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} allrqaysalfrrtstfaltvvlgavlferafdqgadaifehlnegklwkhikhkyease
Timeline for d3l71w_: