Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.28: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81532] (1 superfamily) membrane-associated alpha-helical protein; no transmembrane helices |
Superfamily f.28.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81531] (1 family) location - intermembrane side of the bc1 complex automatically mapped to Pfam PF02320 |
Family f.28.1.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81530] (2 proteins) "acidic/hinge protein", essential for the complex formation, interacts with the functional domain of cytochrome c1 |
Protein automated matches [190042] (3 species) not a true protein |
Species Chicken (Gallus gallus) [TaxId:9031] [189230] (8 PDB entries) |
Domain d3l71u_: 3l71 U: [180023] Other proteins in same PDB: d3l71a1, d3l71a2, d3l71b1, d3l71b2, d3l71c1, d3l71c2, d3l71d1, d3l71e1, d3l71e2, d3l71f_, d3l71g_, d3l71j_, d3l71n1, d3l71n2, d3l71o1, d3l71o2, d3l71p1, d3l71p2, d3l71q1, d3l71q2, d3l71r1, d3l71r2, d3l71s_, d3l71t_, d3l71w_ automated match to d1bcch_ complexed with azo, bog, cdl, fes, gol, hec, hem, pee, uq |
PDB Entry: 3l71 (more details), 2.84 Å
SCOPe Domain Sequences for d3l71u_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l71u_ f.28.1.1 (U:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} elvdplttirehceqtekcvkarerlelcdarvssrshteeqcteelfdflhardhcvah klfnklk
Timeline for d3l71u_:
View in 3D Domains from other chains: (mouse over for more information) d3l71a1, d3l71a2, d3l71b1, d3l71b2, d3l71c1, d3l71c2, d3l71d1, d3l71e1, d3l71e2, d3l71f_, d3l71g_, d3l71h_, d3l71j_, d3l71n1, d3l71n2, d3l71o1, d3l71o2, d3l71p1, d3l71p2, d3l71q1, d3l71q2, d3l71r1, d3l71r2, d3l71s_, d3l71t_, d3l71w_ |