| Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
| Fold f.23: Single transmembrane helix [81407] (38 superfamilies) not a true fold |
Superfamily f.23.13: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81508] (1 family) ![]() |
| Family f.23.13.1: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81507] (2 proteins) |
| Protein automated matches [191133] (1 species) not a true protein |
| Species Chicken (Gallus gallus) [TaxId:9031] [189229] (4 PDB entries) |
| Domain d3l71t_: 3l71 T: [180022] Other proteins in same PDB: d3l71f_, d3l71h_, d3l71j_, d3l71s_, d3l71u_, d3l71w_ automated match to d1be3g_ complexed with azo, bog, cdl, fes, gol, hec, hem, pee, uq |
PDB Entry: 3l71 (more details), 2.84 Å
SCOPe Domain Sequences for d3l71t_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l71t_ f.23.13.1 (T:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
ihfgnlarvrhiityslspfeqraipnifsdalpnvwrrfssqvfkvappflgayllysw
gtqeferlkrknpadyend
Timeline for d3l71t_: