SCOPe 2.08: Domain d3l71t_: 3l71 T:

Lineage for d3l71t_ (3l71 T:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.13: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81508] (1 family)
   automatically mapped to Pfam PF02939

5. Family f.23.13.1: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81507] (2 proteins)

6. Protein automated matches [191133] (1 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [189229] (8 PDB entries)

8. Domain d3l71t_: 3l71 T: [180022]
   Other proteins in same PDB: d3l71a1, d3l71a2, d3l71b1, d3l71b2, d3l71c1, d3l71c2, d3l71d1, d3l71d2, d3l71e1, d3l71e2, d3l71f_, d3l71h_, d3l71j_, d3l71n1, d3l71n2, d3l71o1, d3l71o2, d3l71p1, d3l71p2, d3l71q1, d3l71q2, d3l71r1, d3l71r2, d3l71s_, d3l71u_, d3l71w_
   automated match to d1be3g_
   complexed with azo, bog, cdl, fes, gol, hec, hem, pee, uq

Details for d3l71t_

PDB Entry: 3l71, 2.84 Å

PDB Description: cytochrome bc1 complex from chicken with azoxystrobin bound

PDB Compounds: (T:) Mitochondrial ubiquinol-cytochrome c reductase ubiquinone-binding protein qp-c

SCOPe Domain Sequences for d3l71t_:

Sequence; same for both SEQRES and ATOM records:

>d3l71t_ f.23.13.1 (T:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
ihfgnlarvrhiityslspfeqraipnifsdalpnvwrrfssqvfkvappflgayllysw
gtqeferlkrknpadyend

Timeline for d3l71t_:

• d3l71t_ first appeared in SCOPe 2.01
  
• d3l71t_ appears in SCOPe 2.07