Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.23: Single transmembrane helix [81407] (38 superfamilies) not a true fold |
Superfamily f.23.14: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81514] (1 family) |
Family f.23.14.1: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81513] (2 proteins) |
Protein automated matches [190326] (3 species) not a true protein |
Species Chicken (Gallus gallus) [TaxId:9031] [189231] (4 PDB entries) |
Domain d3l71j_: 3l71 J: [180020] Other proteins in same PDB: d3l71f_, d3l71g_, d3l71h_, d3l71s_, d3l71t_, d3l71u_ automated match to d1bccj_ complexed with azo, bog, cdl, fes, gol, hec, hem, pee, uq |
PDB Entry: 3l71 (more details), 2.84 Å
SCOPe Domain Sequences for d3l71j_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l71j_ f.23.14.1 (J:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} allrqaysalfrrtstfaltvvlgavlferafdqgadaifehlnegklwkhikhkyease e
Timeline for d3l71j_: